PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr018111.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 495aa    MW: 53713.9 Da    PI: 6.4063
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr018111.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding513.4e-162471148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed +lv++vk++G g+W+++ +  g+ R++k+c++rw ++l
      Pbr018111.1 24 KGPWTGAEDAILVEYVKKHGEGNWNAVQKNSGLARCGKSCRLRWANHL 71
                     79******************************************9986 PP

2Myb_DNA-binding46.58.4e-1577120146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g+ ++eE+ l++++++++G++ W++ a+ ++ gRt++++k++w++
      Pbr018111.1  77 KGSLSPEEERLIIELHAKFGNK-WARMASQLP-GRTDNEIKNYWNT 120
                      57789*****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.0961971IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-221974IPR009057Homeodomain-like
SuperFamilySSF466891.16E-2921118IPR009057Homeodomain-like
SMARTSM007179.2E-142373IPR001005SANT/Myb domain
PfamPF002491.9E-142471IPR001005SANT/Myb domain
CDDcd001672.18E-112671No hitNo description
PROSITE profilePS5129425.35972126IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-2475125IPR009057Homeodomain-like
SMARTSM007172.0E-1576124IPR001005SANT/Myb domain
PfamPF002495.8E-1477120IPR001005SANT/Myb domain
CDDcd001671.17E-1181120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009555Biological Processpollen development
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0090406Cellular Componentpollen tube
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 495 aa     Download sequence    Send to blast
MDGVHKTGGG SHHHHHHHQR GLKKGPWTGA EDAILVEYVK KHGEGNWNAV QKNSGLARCG  60
KSCRLRWANH LRPNLKKGSL SPEEERLIIE LHAKFGNKWA RMASQLPGRT DNEIKNYWNT  120
RMKRRQKAGL PVYPHDLQQE AAAAAFHHQH QLRHSSSSPA CSFSSLFSSS HPRKPNSFSP  180
SQLSLYDHIT STFSSTSDRQ NPNNNYFLQN HHHNSSSLYS NPMTQFHGNG GFAMPLSPVS  240
PFGSSALFNQ SNIPNQTLIG QYNSHGGFGG YNNLSLSSMI MGPATYDPTP LVQGSNPELP  300
SNQTPLSING GSEGQMGGSG YTANEDHYEI APVPSQGNSG LLDDVLVEAQ NISNKKAKSG  360
DSCSSGWSGQ EKGLMVEEEE EEEESAEEGA EDTVSTLKNS GENSAENQRG GSSSLSSIGM  420
IQNEDPLEEM DDDLLSLLNF PSTMPVVSES WYAQGCTSNR ALMRSGVSTS DNVSLEIAKC  480
TVDAIGQDQH CGSI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-31221255107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00287DAPTransfer from AT2G32460Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009353373.10.0PREDICTED: myb-like protein A
TrEMBLM5XAE20.0M5XAE2_PRUPE; Uncharacterized protein
STRINGGLYMA13G38521.11e-106(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF99493240
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.22e-68myb domain protein 101